PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10018977m
Common NameEUTSA_v10018977mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family BBR-BPC
Protein Properties Length: 282aa    MW: 31766.2 Da    PI: 10.0662
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10018977mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind307.64.4e-9422811301
        GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki..rernlalsekkaav...........aerd........maflqrdkalaernka 73 
                      md+dg  +rn+gyyep+ +++ nlg+ql+ si +r++k+    +n +l+++++ +            +rd        m++    ++l++    
  Thhalv10018977m   2 MDEDGLSNRNWGYYEPS-QFRPNLGFQLIPSIIDRNEKPflCPQNPNLITPNNGYrggssssnvmsFPRDytvsdapfMSY----SWLNQ---- 86 
                      9***************9.*********************995566666888888855555555544444477776666666....78888.... PP

        GAGA_bind  74 lverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkk 167
                        +rd+k++++ +++ s ++     +  +++t+ ++ +q            ++++ e        ++++e+ ++++ + + + + pk+kk++k 
  Thhalv10018977m  87 --HRDSKFFSNSPNNPS-NH----HTFLVPDTSRTQPMQL----------LQIPKPE------F-SEVDESLKRRHFSGG-ERAGPKAKKERKL 155
                      ..9*********96665.33....3468899999998888..........2222222......2.245667778888744.4567999999999 PP

        GAGA_bind 168 kkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmS 261
                      k+        ++ +++++++   +ksi++v+ngvs+D++ lPvPvCsCtG+ + CY+WG+GGWqSaCCtt++S+yPLP+stkrrgaRiagrKmS
  Thhalv10018977m 156 KD--------SNVPRMQRERSPLRKSIEMVVNGVSMDIGCLPVPVCSCTGMAQPCYRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMS 241
                      98........3344445567789*********************************************************************** PP

        GAGA_bind 262 qgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                      qgafkk+LekL+a+G+d+s p+DLk+hWAkHGtnkfvtir
  Thhalv10018977m 242 QGAFKKVLEKLSADGFDFSSPIDLKSHWAKHGTNKFVTIR 281
                      ***************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.6E-1382281IPR010409GAGA-binding transcriptional activator
PfamPF062178.0E-842281IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MMDEDGLSNR NWGYYEPSQF RPNLGFQLIP SIIDRNEKPF LCPQNPNLIT PNNGYRGGSS  60
SSNVMSFPRD YTVSDAPFMS YSWLNQHRDS KFFSNSPNNP SNHHTFLVPD TSRTQPMQLL  120
QIPKPEFSEV DESLKRRHFS GGERAGPKAK KERKLKDSNV PRMQRERSPL RKSIEMVVNG  180
VSMDIGCLPV PVCSCTGMAQ PCYRWGCGGW QSACCTTNVS MYPLPMSTKR RGARIAGRKM  240
SQGAFKKVLE KLSADGFDFS SPIDLKSHWA KHGTNKFVTI R*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391183.10.0hypothetical protein EUTSA_v10018977mg
SwissprotQ9C9X61e-152BPC3_ARATH; Protein BASIC PENTACYSTEINE3
TrEMBLV4KBG90.0V4KBG9_EUTSA; Uncharacterized protein
STRINGBra033959.1-P1e-176(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM153471518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68120.11e-143basic pentacysteine 3